3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]
Holy shit its actually happening
CHESS KINO
CHESS TIME
>Gura has long nailsHow will yurifags EVER recover?
oh fuck here we go with chess
NOOOO
Are any of you aware of Pekora?
>>29044735God how the fuck do I draw lines like this
chess retards keep your fucking faces shut
Cute OP!
>chessSTRAP IN FOR ANOTHER HOUR LADS
HEREWEGO
BUCKLE UP
>chessOH NO NO NO
>Ame explaining chessNO AME NOOOOOOOOOOOOO
OH GOD NO TASUKETE NIGGERMAN
MY BODY IS READY FOR INFINITE SUFFERING
Please I’m serious what are the chances of gura ever doing asmr please I’m desperate I need it
oh no
>>29044780>Do you wanna play chess?NOOOOOOOOOOOO
>>29044774Games to stream for Cover, you retard.
/u/fags on suicide watch
Let's go doods!
inb4 gura scholars ame
oh god oh fuck
NOOOOOOOOOOOOOOOOOOOOOO
OH NO NO NO
>scratches you with her nails
ATTENTIONMori shit and farted while streaming and the audio of the shitting and farting was captured by her microphone and heard by all attendees of her stream.
>CUARENTA Y CINCO MIL PERSONAS VIENDO A GURAME JUGANDO JUEGOS DE MESA Y AJEDREZ A LAS 12 45 AMBROS IS THIS A KINO STREAM ALREADY?
>>29044793Negative
Kino soon
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
>this is the tower
Noel has long nails until Flare comes over then she gets them pedicured.
Here we fucking go...
IT'S FUCKING HAPPENING
Loving Ame!Marrying Ame!Taking Ame to bed!Disappointing Ame sexually!Failing to give Ame the living standards she wants!Disappointing Ame emotionally!Getting abused by Ame physically!Having to explain the bruises Ame gave me to my co-workers!Dealing with a failing marriage with Ame!No children with Ame!Screaming matches with Ame!All the appliances in the houses broken because of Ame!I love Ame!
>>29044788>Implying Gura does the fingering
Please god no
Ame you better fucking not drag this shit out again you sandbagging gremlin.
LET ME EXPLAIN
LETS GOOOOOOOOOOOOOO
How we doing, Guramebros?
HERE FUCKING GO!
>>29044780>this artist drew 3 pieces of art in 1 streamfucking speed
Her explanation is already going sideways
>this is the... towerGoddamnit Watson
Haachama Kiara in 20mins... GurAme... the views
The other thread had soundpost OPbaka
>Gura keeps leaning her model inShe really likes Ame
AAAAHHHH
I'M READY
OH NO, KIARA DON'T LOOK...
>>29044808She has confirmed princess asmr will happen eventually.
>>29044788she was talking about a bowling trip during her middle school days when she was still straight lol.shes 100% lesbo now, or at the very least bi
SUFFERKINO 3HEAVEN OR HELLDUEL 1LETS ROCK
Oh shit, I walked away and when I came back they were playing Chess.
>>29044699So does that make Kiara gay because her nails are short
please don't go over Kiarachama, onegai...
>>29044826Red Bull and Kit Kat infused chicken is going to be less painful than this chess
goodnight anons, see you in 4 hours
>>29044780That art is cute as fuck bro.
GET THE FUCKIN POPCORN BROS
YOU GOT YOUR FUCKING MEDS CAUSE YOUR GONNA NEED EM
>AmeSame is fucking boring, why do you guys think this is fun?>Cuz they're cute>Don't talk shit if you can't even speak English, you're basically trying to review a comedy movie you don't understand>Oh yeah? Explain how boring it is in detail, you obvious Pekofag.>I can see your tail poking out, nousagi.>You're totally right, bro! Let's talk about Pekora some more! If it isn't Pekora, it's boring! Pekora pekora pekora! Kill yourself.
PTSDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
>Big Kiara collab in 20 minutes>Amegura start a chess matchThey hate her
What you don't know, my dearest little Amelia, is that I've secretly been practicing with Magnus Carlssen.You are in for a world of pain.
Hey, can I join HoloEN?
Yes play chess!
Imagine if Gura was a part of the chess club and is secretly laughing at Ame as she struggles to teach the basics
>Watson explaining chessThis is going to be a long one
Ame terrible at explaining this game holy fuck, this is already kino.
AHHHHHHHHHHHHHH
HAACHAMA YOUR COLLAB ABUNAI
>>29044788>>29044829
HOW MANY HOURS WILL AME THROW THE GAME NOW?
>>29044843I'm feeling great
https://www.youtube.com/watch?v=hrIT2wBxb70Chess music
>>29044859anon...
>>29044780>ChessOh boy
AAAAAAAAAAAAAAAAAAAAAAAAAA TASUKETE NIGGERMAN
After Gura straight up said her name on that Minecraft collab, Ame will probably link directly to HER in Gura's twitter.
THEY GONNA FUCKING FALL A SLEEP
>>29044780WHAT HAPPENED TO IOFI!?
BETS ON HOW FUCKING LONG THIS WILL TAKE
>this is the... towaGoddamnit Watson
>>29044821On your back after you get done ground pounding her
>>29044797But Kiara on HAACHAMA COOKING is in less than 20...
>>29044856What the fuck is princess asmr?
I thought it was ending soon, didn't expect another hour to be added on top.
>>29044900towa...
>>29044874What?
>>29044874>I can see your tail poking out, nousagi.Fucking lol
>>29044843enjoying the best duo in hololive.
>>29044874kek
This cheeky brat knows how to play
>ame doesn't know how to play either
>chessI WANTED TO GO TO BED SOON
>not saving the chess for Ame Kiara rematchmeh.
>Chesshttps://www.youtube.com/watch?v=LQWWOZPTyOw
>>29044874Holy shit
>>29044874why is Kiara posting there?
How have they never played chess before? Why are girls like this?
>>29044874
>chat is going wild
>>29044900The what?
>>29044788past tense also dildos exist
>>29044885Very good narrative. Would make for a very kino revenge.
>>29044874Ironic
Time for cringekino
>>29044907Nobody knows but that's what she said.
>>29044793
>>29044874How will nousagi ever recover
>>29044874lmfao they are just like us
>>29044874Wow it's just like home.
>>29044874Ogey rrat bros!??
>Starting Chess right before Haachama Cooking with ChickenRIP. Any posts about the collab will be buried under Chess seething.
>>29044822I have terrible earwax and did not hear it at the time, can you give me the timestamp?
towa...
ZZZZZzzzzzzzzZzzzzzzzzThe state of HoloEN
>>29044874holy based
>>29044874同じだ
>>29044880>dead narrativeTime to retire this one, cuck.
Game theme
>>29044881Sure Haachama. Only if you drink Onii-chan's secret chinpo milk. It will make you smarter
>>29044885You dork. Go back to the chess club.
>>29044874>pekofags are also the resident falseflaggerswe really are one and the same
>the blind teaching the blind to play chess
>>29044859Trannies in full dilation
>>29044874/hlg/ is 5ch!?
kiara...
>Does it make sense?>Y-Yeah...
>>29044907no idea but i'm gunna coom
>>29044874Based 5ch
>>29044866sorry chickenbro, the collab also got shadowbanned so we'll probably see 15k tops.
>>29044874>one of us etc.
>>29044874I can't believe how fucking similar we are
The fuck kinda ghetto Pirc defense is this opening
Chess Newton
GUYS BET NOW WHO WIN THIS CHESS MATCH?
>>29044874peko is cute though
At what point is this bitch gonna get better internet? She can only use the "muh ISP" excuse so many times. You're a professional streamer for god sakes, stop spending it on your fucking bbc boyfriend
>>29044793Can’t say I am.
Gooruh is in control
>>29044927so pekofags have the same reputation as chumchads huh
>>29044926most people don't play chess
Shork brain RIP
>>29044874Ah reminds me of home
>>29044874Fucking kek
POST MATCH'S THEMES>https://youtu.be/Jrg9KxGNeJY
>ChessThere goes another 2 hours of my day
>chessmy sanity points.....
>>29044935 >>29044937MOOOOOOOOOOOOT
>>29044874TWO WORLDS. ONE FAMILYYYYYY
The reason why Amelia did this was because the game was going to turn into a threefold rep. By pulling this blunder, she is able to gain insight into Kiara's personality, and "bottom-left" part of her, thus fulfilling her victory condition in a subtle and Watson-ish manner. To look at the picture more properly, think of the chess board not as a game but as a battlefield. Kiara's other options were to take her Queen, which would have made her similar to Huke-papa or to call Amelia out on making an intentionally bad move, which would have made Kiara look dumb since "lol rules of idol". What Kiara chose to do was keep her pride and run away from a free victory. Furthermore, by promoting her pawn to a rook instead of any other piece, Amelia symbolically shows stupidity.
Ame going for that fucking grob's opening
>>29044874Even 5ch hates pekofagsAre we really different?
>>29044874[EN] ogey
>>29044793Pardun?
>>29044893>young scrollsULTRA BASED
>>29044874Do they ogey-rratpost in there? They're missing out.
>>29044874Yep, it's a fucking mirror. Neat.
https://twitter.com/walfieee/status/1326777295466618880Based Walf never stops
>>29044881No but you can join my heart.
>>29044874it's like looking into a mirror
So will Ame go full chessmode to end this before Kiara?
If Gura wins Ame is actually a trog
>>29044874This kills the nousagi
>chess newton
>Long painted nails irlSo this is where they came from?
>>29044874Nousagis still butthurt King Same replaced Pekora as 5ch's /ourgirl/
>>29044793Nope, sorry. Is that some kind of company?
gura with the spanish
>>29044973Where do you live that you have more than one good option for internet?
You guys really think Gura doesn't know chess?
>>29044984based
kek rip kiara hoping for viewers in her haachama collab It's chess time
>>29044971Pekora
>>29044988SANchi pinchi...
>>29044851Who wouldn't she's adorable.
>>29044874how do they even say shit like "pekofag" on japanese?
>>29044874God, that rabbit is just a universal tool for shitposting, isn't she?
>>29044874rrat
>>29044874It's scary how similar we are sometimes...
>Artist>alien>Multilingual>be low enough subs to do anything you fucking want>have a small cult community>Soft genki energy>instead of capitalizing on this like Moona and Risu, she still insists of becoming a conventional chuuba>Now pigeonholes herself on the translator roleI wanna support Iofi, and I do, but I can't stay interested in her streams. Now I hate consumer culture and the endless thrist for novelty, but she should definitely try something shocking and novel. I hope this mindbreaks her into the mad artist route
Size queen+ Long nails ... its over /u/ bros
All right so we know Ame will be writing something on Gura's account. But what would you all write on Gura's account?
>she's a vektroidchad
https://www.youtube.com/watch?v=YgeYScYe8wI
>>29045020You really think she knows?
>>29045020that's my girl
WITNESS YOUR DOOOOOOOOOOOM
is ame humming nene's end theme cha cha cha?
>>29044980t. seanig
>so it's a brain game
>>29044874Wtf its the same thread but just in jap lmfao
zzzzzzzzzzzzzzzz
Well, /hlgg/? Is Ame still pretending to play badly?
>>29044984Now I'm feeling motivated!
>>29045028This level of interaction must be weird to do, it's like green screen acting
>>29045019Same place this bitch lives ca
>>29045048you will never function in society
>>29044874Holy fucking shit
you guys understand most women wear fake nails right? and they fall off when dipped in nail polish remover?
>>29044874All those losers replying to bait. That guy is laughing with all his (you)s
>that pawn on D4absolute madlad
>>29044926Most people have never played chess before
>Ame intentionally overloading the shork brainDirty play, Watson
GM Hikari vs Gura
This only adds to my entertainment but could Ame get any more unsportsmanlike?
>>29044874Like a mirror etc.
this isn't nearly as painful as the kiara/ame chess match because we know from the start gura has no idea what the rules are
>>29044822Stop shitposting with my oshi!Heh, get it?
>>29044862Yes, anon. That's why Kiara is gay. That's the reason.
strategy bros.....
>and a sandwichit was a fucking burger
Ame activating her rook early, Gura going for the queen's pawn gambit declined and re-extended
LEAVE GOORUH TO ME
>>29045020Her psyop requires her to pretend not to be a pro chess player
>they know
Ame bringing up food.Shes trying to steal this win.
why did they choose to play chess at this time?
How malnourished is Gura?
guys Gura is too fucking retarded I can't handle it
>>29044874In the entirety of my life, there has never been one thing that humanizes a foreign people making me view them the same as my own people as much as 5ch vtuber dumpsterdive shitpostingThey are literally the same as us
>Gura can barely keep her thoughts togetherSee you guys after the collab
>>29044984https://www.youtube.com/watch?v=Z9dNrmGD7mU
It's 10 years in the future; a woman with slightly aging features and a sickly, raspy yet familiar voice asks you "Do you know pekora?"How do you reply?
>>29044926I have no clue how to play because I have almost 0 friends
>>29045038geez nearly all those could apply to Kiara as much as they did for Iofi.
>>29044874>I can see your tail, nousagiKek
>>29044874>Separated at birth
https://www.youtube.com/watch?v=0RHLtx9r2LAchess is lame and imbalanced!
If only Amelia knew enough about chess theory to open with this move
>>29044874How long until they pickup ogey/rrat?
>>29045073If by most people you mean most people in shit 3rd world countries maybe.
>>29045093Because they hate Haachama
after watching this gurame collab, i dont think i can watch any non-gurame 51 collab ever again and derive the same amount of enjoyment.why the fuck is their relationship so kino. its literally just them talking about their lives and them (as a person) rather than only restricting conversation to the game - which is something that people that are unfamiliar with one another do (iname, kiara+ame)they also have the capacity to banter and make bets, as opposed to being overly friendly with one another like typical coworkers.then you have gura literally leaking, which only happens when she collabs with ame. that just shows that she's extremely comfortable and can be herself near ame.not to mention they literally make each other laugh every 10 seconds. and its not the fake, forced laughs you hear them make, especially gura. its genuine, unfiltered, kino laughter.this duo is literally okakoro tier, but as someone that cant understand japanese i am not fully capable of enjoying the intricacies and pragmatic dynamics of okakoro. as a result gurame is literally like a fucking slap in the face, telling me that THIS is how good duo holo collabs can be. based.
>>29045055never was.hell, even she admits that she doesn't think her moves through. which is different from playing badly on "purpose."
Watson has learned to distract Gura with food.
Gura is going to activate THE WOODEN SHIELD and destroy ame in the next 10 moves.
>>29045100NO
Why the fuck does this game let you move over illegal spaces?
>>29044874KEK
>That knightI'll allow it
>do you know the goal of the game
>>29045039Lesbians/bisexual women will often have long nails on all but 2 fingers. It's not over for (yo/u/).
It hurts to admit but I'm convinced Kiara is smarter than Gura, I know for a fucking fact Ame is sandbagging from her previous twitch life.
Go on Gura... make your move
>>29044881Sure! Australian English is basically gibberish.
>>29045087TSM!
salmansoup (including vegetable chicken soup)pizza without cheesepizza with smoked salman and arugula (and cheese)avocado (she grows them and makes her own guacamole)veggie stickssandwiches
HOLY SHIT GURA LEGIT CAN'T THINK WHILE TALKING WOAH...
>>29045094Some say shes still skipping meals because they go the way of the bread
>>29045100pardun?
This game is pain
>>29044874C...COPE
>>29045119Filtering people by wasting their time
>>29045100One final no_
10 minutes Ame can you stop sandbaggi
https://lichess.org/6CAcWMaSAnyone wanna play a round?
>>29045087Hikaru is the biggest faggot in chess.
>>29045015>No blue nailSomeone fix this please
>>29044984https://www.youtube.com/watch?v=wb23Yk3gKsE
https://www.youtube.com/watch?v=fzHbBACDfUoReminder for everyone, Haachama gonna cook Kiara in 10 min
>>29044859t. my ass
>Had to think in order to make up what she ate today.Gura is anorexic it's so obvious at this point lmao.
>>29045109the advanced bong cloud
what is Gura thinking about when she doesn't know how the pieces move
Gura... your en passant reps...
GuysI don't think I can fuck Gura anymoreI meanI could start fucking her and she would be there thinking "Uuuh so this is sex? This is weird why are we doing this" while making weird dumbass sexy noises
KIARA NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
Why the fuck would anyone bother playing solved perfect information games? Are you really that dull?
>>29045020Gura is actually 2400 elo in chess.
OK, I'm out. I can't do this
Gura is pretty great at pretending she isn't secretly 2200 ELOGood acting I gotta say Amelia doesn't know what's about to hit her. Gura just did a foé-deux opener. No noob would do that.
>>29045109>implying she isn't doing retarded shit like walking rook out on purpose.
>>29044874wow, 5ch really isn't that different than we are.
>>29045126kek
>Kill the kingOh no they're gonna pretend to not know how a checkmate works again...
>>29045131>avocado (she grows them and makes her own guacamole)Farmer Gura cute!
>>29045112Most people in America have never actually played chess. Why would you think most people have played chess?
Kiara begging for views
10 minutes.... GurAme onegai....
>>29045164this is retarded enough kiara
>Kiara offering to help
>>29045095I just wish Gura would move on from Ame. Yeah, their collabs are great but both of them need to start doing collabs with other people. Ame is reaching out to other people but Gura seems content to staying within HoloEN, mainly with Ame.
>>290451123rd world scum here, everyone I've met knows how to play chess
>>29045163>ask her about food>she forgets about the cock inside of her and tries to think of what she ate
I need popcorn
>>29044874Holy fucking based
>>29045163>I don't think I can fuck Gura anymoreWhy did you think you ever could?
>>29045124he didnt mention male roommates and known bf, /u/ fags will get the rope
>AME INVITING KIARA TO BACKSEAT GURA CHESS IN CHAT
>Kiara arrives to shut the stream down
>You don't wanna spend more time with meUOOOOOOOOOOOOOOOh
>>29045151>haachamauhm nah
>>29045151Anon... I have to sleep
Ame CONFIRMED DESPISES GURA GUYS IT'S OVER
>YOU DON'T WANT TO SPEND TIME WITH ME>WAHHHHHHHHHHHHHHHHHH
ENTERCHICKEN
>>29044921>10 hoursI don't think that'll be long enough for this
>>29045164what the fuck, don't you have a collab in 10 minutes?
This game is already hurting me
Gura...
kiara leeching
Ame doesn't want to spend time with Gura anymore. GurAme is dead
GURAME IS SO CUTE GOD DAMMIT I'M NOT INTO YURI AT ALL BUT IT'S OBVIOUS GURA HAS ACTUAL FEELINGS FOR AMELIA CMON
IT'S TIME https://www.youtube.com/watch?v=YcqI9FdpvNs
>>29045170what the fuck is a foe deux opener
ok ive been gone for about 40 minutes, anything of note happen? i see gura was merely pretending to not understand chess.
>>29045187Your tail is sticking out nousagi
Gura literally whining to spend more time with Ame
>>29045185ARMPIT PUSSY
Guys is this more braind damage than the Kiara Ame chess>?
THE BISHOP TAKE THE PAWN AND THEN FORCE THE KNIGHT TO BE TAKEN
>"you don't want to spend more time with me?"discord sex confirm.........
>Kiara please help GuraReminds me of the three blind rrats
>kiara is trying to leech etc etc.
I can't take this anymore, who is going to watch Haachama/Kiara stream instead?
>>29045166Chess isn't solved yet, it's only been proven to be solvable
I hope someone models this game like the last one so we can see how bad they were on a technical level
>>29045100After what I heard she did to Kiara on the eve of their collab, even I'm no longer sure I know Pekora.
>>29045180chess retards exist in an echo chamber like no other
Kiara is rushing them to stop because she has stream in 8 min
>>29045180>Why would you think most people have played chess?Because I go outside and know hundreds of people and most of them have played chess at least once in their lives?
Gura is doing a secret strategy that is going to checkmate Ame real soonSource: Trust me bro. I'm a double grandmaster super star plus pro.
>>29044907NAAAAA
>>29045214basedpeople that cant see it are literally fucking autistic and have social dysfunction.
>>29045225>Guys is this more braind damage than the Kiara Ame chess>?nope because Ame won't sandbag this
Amelia and Gura are so cute together, it actually makes my cold dead heart feel just a bit warmer.
>You don't wanna spend more time with me?>tfw gura will never say this to youAHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
>>29045087Leave this to a real grandmaster. You couldnt even teach your student to avoid being scholared
>Ame wants to quitNOCONTINUE
>>29045231Isn't that Go?
>>29045232fuck off to some other board you autistic faggot
Who doesn't learn how to play chess as a kid?
>ame wants to quitame stop..
How is Gura actually this retarded
Look at this fucking chessboard and tell me Gura doesn't know how to play. Ame's pieces are clearly worse here.
>>29045170When you're so fucking retarded you look like a genius
Ame realized her mistake
>>29045216This is going to be looped 10 times before this match ends
>Gura calling out Ame for wanting to leaveBASED
Jesus Gura is annoying holy shit
>>29045201based Gura/Ame/Mori chad
gura is literally in love with ame, doesnt care if this shit takes another 2 hours
>developed only the right side of the board
Ame seemes to be having fun
THIS COLLAB WAS GOING A LITTLE TOO WELL FOR MY LIKING
Ame should've let Gura watch the tutorial
>Take an hour and a halfDidn't know she intended to speedrun it
My sides
Alright guys. What would you guys write on Gura's account if you had the chance?
That bitch Ame is making my cute daughter Gura suffer through a game that she never even played before without explaining how it works
oh no Kiara is going to have a meltdown over Gura
>>29045248>tfw I can't wait to go to sleep tonight and pretend my pillows are both Ame and Gura
>>29045255poor people, uneducated people
Ame just demolish Gura and end this stream.
>ame trying to quitfuck this two faced bitch. holy fuck that just killed this collab and ruined my mood immediately.
>>29045251Mori don't you have a date to prepare for
>>29045282UUUOOOOHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Anyone heard of 5D Chess with Multiverse Time Travel? That shit is great.
Damn, Gura is being really thirsty for Amelia right now. What's the narrative?
Fuck this, I'm not watching a complete retard who's never played chess fumble for another 1-2 hours, you win this time Kusotori.
Gura the Kiara Haachama collab is coming up....
>>29045237>Desperately trying to stop the 50k viewer stream from killing hers
This is such a shit show its fantastic
>>29045237>Kiara is rushing them to stop because she has stream in 7 hoursFixed
>open stream>chess>close stream
>>29045116Amechaama 51 collab was much better though.
>>29045251Why did I read this in his voice?
>Ame finally realizing that this was a horrible idea and trying to back outWE'RE DOING IT LIVE, AME
Gura is like a autistic kid wtf
Ame literally playing against herself like that wojak meme
>time is running out>make your moveNobody caught the vaporwave reference?
>>29045270yego
>>29045270haha look it's a retard
>>29044874"You and I are opposite sides of the same coin. When we face each other, we can finally see our true selves. There may be a resemblance, but we never face the same direction."
>>29045279more likeMY STREAM IS STARING SOON CAN YOU POWER HOUSES PLEASE STOP I ALREADY GET LOW WNOUGH NUMBERS PLEASE
>>29045288you're glowing too much
>>29045288Calm down. She's doing it out of consideration for Kiara.
>No castling
So will Ame sandbag and let this take forever OR will she unleash her hidden power
https://lichess.org/qnYbEQXF
>>29045112third world knows more about chess by the end of grade school than y'all hamburgers
>viewers decliningITS OVER FOR GOUDA
Alright guys. What would you write on Amelia's channel if you had the chance?
>>29045103yep. all but the last one
>>29045288meds
>>29045301>7 hoursDon't you mean 7 minutes?
I feel The Warp overtaking me... It is a gooooood pain!
>>29045286The poor and uneducated people where I am from know how to play chess. It's seen pretty much as a social game here
>>29045295she's having fun
ok this is actually painful
>>29045308people hate vaporwave because it got memed oni got it though
>>29044907
>>29044984https://www.youtube.com/watch?v=HPe4G9BiIc4
>>29045288anon your retard senses are tingling, Ame knows best as the only actual streamer of Hololive
>>29045288no its because Gura is annoying, she is literally wasting Ame time.
>>29045308It seems chat is way too retarded to have caught it. I caught it anon, it was kino.
>don't you want to spend more time with me...>I mean, if you want to go that badly...>hey ame, uhm,.. what if we did like a movie watchalong together sometime...>hey ame, thanks for uh... putting up with me all this time..
What are you guys doing while you're watching Amesame hellchess?I'm doing some shiny hunt
>>29045288Tell me rrat, are you ogey?
>>29045308Damn I almost missed that
>chess noobs ITT don't even realize Gura is setting up an Atlantis ManeuverLol...
>>29045255He didn't tell her how
>>29045238Most people I know have touch chess pieces but never actually played the game.
>Go one to the left>That pauseGura... Your directions...
GOD I HATE CHESS SO MUCH
GuraAme chess is actually worse than KiaraAme... This game might actually give me a reason to kill myself.
AAAAAAAA HOW DO I USE THIS MY BRAIN OOOOOH NOOOOOOOOOOOOO
>"yeah so can you hurry up and like finish?"
In 6 minutes the stream will die due to "Internet issues"
>>29045288you're more sensitive than Gura's nipples, relax autismo
Ame sucks at explaining chess
>>29045331yammy
>>29044984https://www.youtube.com/watch?v=R_TbF5m5KpU
>>29045298Not really surprised since this is actually a timeslot that she could get more than 10k people.
For the next gen of idols Yagoo should make sure they can all pass a simple IQ test.
I thought this would be kino but she is just teaching her.
Ame is just playing against herself so this counts as her win either way.
>>29045338Ultra Nightmare in Doom Eternal
>>29045326GUNS HOTBLOOD COLD
>>29045338I am very drunk right now and I dread going to work with a hangover again
Today we learned that gura doesn't understand the concept of squares and doesn't understand the concept of Ls
>>29045251He was better before the face reveal, you can't deny it Mori
>>29045318To be fair, it's late night here in burgerstan. people will finish it later with VOD.
Ame doesn't know how the knight moves either lol
>>29045357what did you expect for a first time player??
>>29045153>anorexicThose people are insane.
>>29044874nips really know how to take care of their antis
who the fuck asked for chess this shit is bORIGN
pawns can go backward.
>>29045337>Hey Ame... Thank you... For teaching me how to play Chess...>Uh... Ame... Can we do... "That"... Again? ₕᵤhaʰᵃha!
>>29045341The one you loose so bad that you might as well drown yourself?
>>29045237Ame wants to be considerate of Kiara. Gura doesn't give a shit.
I want to go sleep but I just cant stop watching, I am way too addicted
>>29045337Gura was pushing hard for that movie watch along collab a few weeks ago, wonder if they'll really do it.
>>29045356They'd filter all the good ones
Gura lost an entire loaf of bread in her apartment.
Neither of them know how to move chess pieces
>>29044874>>29045097standing here i realizethat you were just like me
Girls who've never played chess before are bad at chess noooooDo I fit in yet
>>29045378maybe side to side too!
>>29045337I would call it gap moe but i'm not sure how gap it is
This is why ame didn't want to play chess lmao. She said Gura never played
AMELIA WILL CHECKMATE GURA IN FIVE MINUTES!
Yeah, better watch Kiara instead this dumb retarded stupid show
>>29044984https://www.youtube.com/watch?v=oXlCeJfLhJM&ab_channel=TheRifson
Ame...
>>29044926This might actually be an age issue. Board games were all we had before smartphones took over the world.
>>29045323More like all but the last 3>Soft genki energyNo>instead of capitalizing on this like Gura and Mori, she still insists of becoming a conventional chuubaKiara is bottom left not conventional>Now pigeonholes herself on the translator roleCorrect she isn't doing this
>>29044749Did she mention them before? I've missed a few of the recent Gura streams.
>>29045364not really, but its fun to think so
>>29045356>chess = iqwhy are all chessfags like this?
>>29045364She's good at pressing two buttons at precise timing though.
What if Ame makes a HER reference on Gura’s Twitter?
>>29045364mmm grayons
Where the hell is the Kiachama collab? I don't see it on either of their channels.
>>29045357I don't know what anyone expected when Amelia repeatedly said that Gura has never played./hlgg/ proving its IQ to be about 10 higher than chat's at best.
>>29045320You guys are worse than gura
>>29045107Chess IS imbalance. If the best white player and the best black player play against each other, the white player will always win.
>>29045338I'm working.
>>29045389Was this the karaoke?
>>29045337And people say that Gura doesn't like Ame more than the other way around,
AME'S KING IS LITERALLY IN A DEATH TRAP C'MON GOORUH, YOU CAN DO IT.
GG Gura has AI assit.
>>29045364>doesn't understand the concept of LsIt's quite difficult when you're at the top
Guys please save Gura pic related is going to kill her its running ITS FAST I CAN'T STOP IT HE'S USING THE L MANEUVERRRRRRRRRRRRRRRR
>>29045415https://www.youtube.com/watch?v=fzHbBACDfUo
>>29045383Ame said she's waiting for Gura to plan it
>>29045338listening to mori's pet snake
more and more you begin to understand how this girl managed to lose a piece of bread
>>29045383Ame brought it up last week and sounded like she liked the idea so it'll probably happen
OH NYOH
Ame Kiara was the greatest chess match in this milleniaThis just makes me roll me eyes.
>>29045288SEA nigger calm down.It's been 2 and a half hours and Kiara has a pretty big collab in like 5 minutes. They probably should have stopped already.
>>29045415shadowbannedhttps://www.youtube.com/watch?v=fzHbBACDfUo
1. I want to see Hololive Poker matches2. Amelia needs to end stream before Haachama's starts
She's sandbagging so hard wtf
>>29045387>ApartmentShe has a garden that has two avocado trees, she doesn't live in an apartment
I'm getting some major whiplash going from watching that Deep Blue documentary earlier today and coming to watch... whatever Gura and Ame are doing now.
>>29045410Chimkin.....you numbers....
>pawn into losing knight as punishment???
Odds on Ame mentioning the Haachama collab before ending stream?
>There's an assist modelmao
>>29045415Shadow banned https://www.youtube.com/watch?v=fzHbBACDfUo
>>29045415Why are you not using jetri and depending on youtube absolute shit system
>That jabR00d
How can you go trough life not knowing the absolute basics of chess.
this game is worse than amnesia rebirth
>>29045356There's no real correlation between being good at vidya and being functionally smart when it comes to vtubing, see Aqua and Botan's respective scores on Coco's test.
>>29045338Tempted to work on my writing or even do my minecraft creative reps
>>29045288nice bait
>>29045338Heartgold randomizer and looking for nut materialeither to gura or 3DPD
>>29045435a LOAF of bread
https://www.youtube.com/watch?v=fzHbBACDfUoBetter stream starting soon.
>>29045258Todd was a negligent father
>>29045449kiara... i want to sleep... don't do this to me...
>>29045454that video was pure kino
>Gura is already defending her pawnand people say she isn't Hikaru's personal teacher
>>29045397t. chickenfag
>>29045356Can’t wait for a former NASA scientist vtuber streaming lectures about quantum physics.
If she loses it's Risu's fault again.
This is starting to drag on, see you guys in the haachama collab
Oh no... Kiara....
>>29045425Gura likes ame way more than ame likes gura, you can be severely autistic and still understand this.
>>29045435she even looked in the washer and dryer for goodness sake, there's no helping this one
>That laugh before Ame's rook moveShe knows
>>29045286Poor people are better than chess than middle class suburbanites
So...She dead?
>be Ame>have to choose between Kiara and Gura and who to pleasesadame.jpg
>Gurame collab>overlapping Haachama chicken collabAAAAAAAAAAAAAAAA MAKE BETTER SCHEDULES
>>29045415How does she keep getting shadowbanned?
What's this do? Shouldn't Gura be using this?
>>29044984I'm not complaining but where is the crossover between /v/ DMC posters and cute girls playing games?
>>29045445>>29045462>shadowbanned collab againGod is chicken anti
>>29045465I didn't know how to play until a couple months ago.
>>29045459where's the stream?
>>29045465I know how pieces move, but anything beyond that is fucking rocket science to me.
>>29045491Hopefully.
>gurame collab about to overlap kiarachama for an additional hourhow mad do you think kiara is right now, being the biggest numberfag in holoEN?
>>29045424it was the japanese learning stream
>>29045472>Cooking with hachamaNot so sure about that
what percentage of the population of 20-28 year old females knows chess you retards?
>>29045491fuck off to vyt
>Ame literally letting Gura use her queen to put her in check>Gura doesn't see it
>>29045435LOAF, Anon. The whole thing
Final Verdict: does Watson know???
kind of boring but still a sweet stream
>>29045000They NAAAAAAAAAAAAAAAAAAA post instead
>>29045454Fredrik Knudsen is an easy 10/10Fuck IBM
>>29045491Fuck off.
>>29045322600k Celebration - 24 hour Gwent endurance stream 11/21 8AM PST/11AM PST - 11/22 8AM PST/11AM EST
>>29045495It shows you where a piece can move when you enable it, so yes they should be using it
DEVELOP YOUR PIECES
>>29045412Gura's entire existence is a HER reference. Stop saying this shit.
>>29045465most people do not play chess. you need to really, deeply internalize that. chess is not a popular game.
>>29045445>>29045462how do you get shadow banned for a stream that hasn't even started?
WE INTERRUPT YOUR CHESS STREAM WITH CLOWN MUSICVenomhttps://files.catbox.moe/hi4u2e.webmfloshttps://files.catbox.moe/cawe1c.webmMokusei no Beathttps://files.catbox.moe/3ntycj.webmCynical Night Planhttps://files.catbox.moe/afyc2v.webmAutophagyhttps://files.catbox.moe/tf77y6.webmHibanahttps://files.catbox.moe/aub2vz.webmCharleshttps://files.catbox.moe/br0o4h.webmTeikoku Shoujohttps://files.catbox.moe/g0syut.webmManichttps://files.catbox.moe/qj6ppk.webmBitter Choco Decorationhttps://files.catbox.moe/nbh97c.webmMairieuxhttps://files.catbox.moe/mjyaxe.webmWhole Lotta No'shttps://files.catbox.moe/90l4xa.webmDelusion Sensation Compensation Federationhttps://files.catbox.moe/odmwh4.webmRokihttps://files.catbox.moe/7bx7q6.webmAhegaodoruhttps://files.catbox.moe/ooelki.webmDelusion Taxhttps://files.catbox.moe/3cr2e8.webmGhost Rulehttps://files.catbox.moe/c74nej.webmTengakuhttps://files.catbox.moe/60c2ft.webmSand Planethttps://files.catbox.moe/phf510.webmOtome Kaibouhttps://files.catbox.moe/6kiw9l.webmLiterary Nonsensehttps://files.catbox.moe/c44jmd.webmUnknown Mother Goosehttps://files.catbox.moe/7p7c9v.webm Gurengehttps://files.catbox.moe/u6y6px.webm
>>29045484Agreed, I can't watch another hour of this. Chat is retards for making them do this and should kill themselves.
>>29045509You never wanted to learn how to make KitKat and Redbull Chicken with gyoza?
>>29045508she's probably more upset that another stream she's in got shadowbanned
>>2904550899% she will quit HoloEN go back to Austria resuscitate Hitler start the 4th Reich kill 6 billion Jews and launch a nuke towards Gura and Ame's house
>>29045195If there was proof of that it'd be spammed in these threads
>>29045514No
>>29045255I was never taught how to play chess, most people I know where never taught how to play chess. It's not a game a lot of people play.t. american
Let's expand this question1. your oshi2. What you would write on their twitter if you had the opportunity
>>29045445Why does that keep happening?
Gura could literally win in two turns considering she's against Watson
Kiara gonna get 50k views
>>29045495She already pressed it and got confused. Didn't you hear her say "what are all these colors?"
>>29045492They started like half an hour late because Watson forgot how time works
>>29045495>Assist Mode comes in two flavors. With it simply turned on, you can move the cursor over a piece and see what spaces it can legally move to, and you also get highlights showing the last piece moved. If you hit the Assist Mode button again, you'll see a "Threat Map" that will show you colors denoting what spaces are "guarded" by pieces. A blue space is one that you can attack. A red space is one that an enemy attack. A deeper red/blue means multiple pieces can attack that spot, and if it's split between the two colors, both players can attack the space.
>>29045397I'm going to do both and I'm going to enjoy my brain turning to perfectly smooth guacamole, thank you very much.
>>29045445WHY ITS SHADOWBANNED AHHHHHHHHHHHHHHHHHHHHHHHH
>>29045508Probably slightly less mad about this than being shadowcucked by Youtube.
>>29044851I was thinking she was definitely doing this on purpose.
I love how nervous Gura gets when Ame yawns during her turn
>>29045465Most people are lucky and don't have parents who force them to play it
>>29045491you lost?
>>29045506>>29045523>>29045511What?I'm just asking if Cover said no you can't keep the models and stuff?
>>29045508I'd much rather watch chimkenchama than this chess match
>>29045512Gura would H5 into the knight capture
Wait till Gura and Amelia find out about en peasant and castling
>>29045531thanks for the bgm
>>29045488to be fair, when you're looking for something you have already seemed to look everywhere else for, you start checking places that seem completely unlikely
>>29045508shes not Watame, but I imagine shes kind of bummed about it. I mean Gurame has been going on for a while now and they know Kiara is streaming soon
Chess was a terrible idea.
>>29045484Ok, bye Kiara
>>29045508The fact that it got shadowbanned she's probably peeved as fuck
I can't wait for Kiara and Haachama to discuss what life in Australia is like
>mfw Amelia is walking right into my trapShe never saw it coming too
>>29045492This is Gura's fault for pushing Am to play chess even though she doesn't know how to play and is too dumb to learn how
>>29045508She's likely more upset about the shadowban.
>>29045531is this the new pankeki post
>>29045494It’s not even Kiara’s channel though? Haachama is hosting it
>Ame finally lowered her bit rate, but only to 7kAme...
Did Watson explained to Gura how to win?
Watchama stretching!
https://lichess.org/m00iuis6
>>29045511if he can't post here he can't post on vyt either. only thing JP about the CN branch was Hololive, without Hololive it doesn't belong in /jp/ anymore. And that /trash/ thread is Western VTubers so basically there is nowhere on the entire fucking website for him to post.
>>29045527This is actually pretty sad
>>29045560en passant...
>>29045537 her was open about it and it was spammed at the start of the split
>asking Kiara questionsAme I think she's busy with something...
>4kshe actually knows how to stream huh
>>29045554Off topic, fuck off to vyt.
Flirting with Gura!Inviting Gura out for dinner!Getting to know Gura!Walking Gura home!Lending Gura my coat to keep her warm!Comforting Gura from her inferiority issues!Holding hands with Gura!Kissing Gura on the cheek!Saying goodnight to Gura!Walking around the back of Gura's house!Waiting three hours behind Gura's house!Climbing up to Gura's window!Cracking open Gura's window and climbing in!Sneaking up to Gura's bedside while she is asleep!Covering Gura's mouth!Taping Gura's mouth shut!Holding down Gura!Slipping my hand up Gura's nightgown!Punching Gura to stop her squirming!Grabbing Gura's ass!Slipping my hand under Gura's pantsu!Fingering Gura's cunny!Pulling up Gura's nightgown!Kissing and licking Gura's tummy!Sucking Gura's perky pink nipples!Licking Gura's armpits!Ripping off Gura's pantsu!Pulling Gura's legs apart!Sliding my cock into Gura!Fucking Gura in the cunny and then the asshole!Cumming inside Gura multiple times!Making Gura my wife!Rubbing my raw cock on Gura's cute little feet!Wiping away Gura's tears!Wrapping my hands around Gura's throat!Strangling Gura until she stops breathing!Carrying Gura out the window!Tossing Gura in my car's trunk!Driving home with Gura!Putting Gura in my garage!Noticing Gura is still alive!Stabbing Gura with my kitchen knife 35 times!Disemboweling Gura!Spilling Gura's blood all over the floor!Cutting Gura's body into various chunks!Burying chunks of Gura in a shallow ditch!Helping Ame search for Gura a week later!Comforting Ame and assuring her Gura is just fine!Flirting with Ame!
Thank fuck Ame is finally streaming at a reasonable bitrate. Now to get a good ISP.
>>29045586nope
>Ame playing better than last time>Gura totally cluelessThe pain was better when she and chicken were doing stupid moves. I'm watching Haachama.
>>29045554And how are we supposed to know that, you goddamn fuckwad
>>29045531Polka has been growing on me as of late desu. I want her to do an instrumental collab with Mori
Everybody go watch Haachama/Kiara stream
>>29045491I liked her gremlin face too bad she's a chink
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
GURA WHAT ARE YOU DOING AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
>>29045491She said in discord it was her last tweet... for the day
>>29045542>move queen into check>king moves>take bishop>checkmateDO IT GURA
>>29045599Based
Why is Haachama shadowbanned? Yesterday's ASMR?
>>29045531And other holos as a bonus:>MioRolling Girlhttps://files.catbox.moe/9nil8t.webm Matryoshkahttps://files.catbox.moe/nq471a.webm Magical Girl Eudaemonicshttps://files.catbox.moe/xuedy4.webm Talent Samplerhttps://files.catbox.moe/1k4bph.webm Being Herehttps://files.catbox.moe/ktye4t.webm >TowaBallerina Girlhttps://files.catbox.moe/7lgmrw.webm Ai no Scenariohttps://files.catbox.moe/xl3t47.webm Moonshinehttps://files.catbox.moe/fu6h4f.webm Sayokohttps://files.catbox.moe/72wwvp.webm Streaming Hearthttps://files.catbox.moe/ol9pqq.webm >OkayuShunraihttps://files.catbox.moe/3lgtcz.webm Hitchcockhttps://files.catbox.moe/shxfbm.webm Alien Alienhttps://files.catbox.moe/oqvuhn.webm aimaihttps://files.catbox.moe/8olulo.webm Talent Samplerhttps://files.catbox.moe/9y51d0.webm >KanataDelusion Sensation Compensation Federationhttps://files.catbox.moe/xjakxm.webm Terrorhttps://files.catbox.moe/p88rj6.webm Streaming Hearthttps://files.catbox.moe/2ov2pu.webm Headlong Girlhttps://files.catbox.moe/f264wl.webm Six Trillion Years and One Night Storyhttps://files.catbox.moe/hy396s.webm >FlareMatryoshkahttps://files.catbox.moe/45pxga.webm Death Fairytalehttps://files.catbox.moe/iod92w.webm Pomp and Circumstancehttps://files.catbox.moe/g4i9vt.webm This is happiness and peace of mind committeehttps://files.catbox.moe/jv8o2r.webm Ten-Facedhttps://files.catbox.moe/27h6st.webm >WatameThe Disease Called Lovehttps://files.catbox.moe/jztb5g.webm L.L.Lhttps://files.catbox.moe/psd252.webm Delusion Girlhttps://files.catbox.moe/x5j5rc.webm Unknown Mother-Goosehttps://files.catbox.moe/hjtpna.webm Let Me Be With Youhttps://files.catbox.moe/i75dhw.webm
Where is the Kiara/Haachama collab? I don't see it.
>have to choose between amelia and haachama
Its not poor chicken, its poor haachama getting her numbers eaten
gura can visualize the apple.
>>29045560I have never heard of en passant until today
>>29045598Uh hello?Retard, Cover is the owner of Hololive.
>>29045593
ah yes the aphantasia talk, who else out here
>>29045542Gura could pick up the knight with a check
she's a god at mental rotation, she's a chem student bros
>There were people in chat who actually thought ame didn't wanna play chess because she was afraid of gura beating her
>Be in first world country>all the upper middle class growing up don't know how to play chess>most of the third world immigrants from some piss poor shithole know how to play chess and are even aware of some basic openingsI think you anons got everything backwards
NPCs...
>>29045611youtube fucking sucks
>gura can you rotate a cube in your mind>y-yeah
>>29045623I'm watching both
>>29045491OH N-
>>29045606This is not about the game, you dolt. It's about them interacting.
when I think of an apple, I don't think of anything. Is my brain bloken
STARTING SOON
>>29045605Fuck, this gonna be rough
https://youtu.be/fzHbBACDfUo
AME KNOWS OF THE NPC'S WALKING AMONG US
They really forgot about Kiara's collab huh
>>29045599Kys
>>29045623>Not watching both
>>29045623Just watch both
Well at least she has internal monologue
>>29045615anonchama... the F4 knight...
>>29045531>tf77y6see you guys in three minutes
>>29045599>FIGWLCHKSWWCCSCTHSPGSFPKSLRPSFCMRWWSCTDPNSDSCBHCFWhat did he mean by this?
>>29045508>gurame started chess instead of ending it, keeping their 40k viewers>shadowbannedGod is a chicken anti
>4k For Haachama's collabJesus, not even chicken has these low numbers
>>29045607I dunno nigger, I thought Cover owned Hololive so it would be news here
What do you see in your head?http://poal.me/dys6s5http://poal.me/dys6s5http://poal.me/dys6s5
>>29045644chess retards are the special needs group among gameplayfags.
>>29045653They're allowed to overlap you know
>kiara stalling her collab til ame and gura are doneultima numberfag
>>29045643Ok I laughed. Take your (You).
>>29045647yes
>>29045623Watch both, numbnuts.
>>29045653Amelia knows but Gura probably forgot.
GURA KNOWS THE CUBE
HELP
>turning off Gura for Kiaraunacceptable>turning off Ame for Haachamaany daywhat do?
Are there seriously people who don't know how to play chess?Who can't imagine fruits?Are there seriously people what can't see tlab
>>29045611thank you susan wojak for this great platform to watch my favorite content creators on
>>29045531>flosDisgusting.Only Okayu has right to sing it. https://www.youtube.com/watch?v=4muYzftomAE
Gura could win Ame's queen right now.
>>29045606Is she really? Her first moves literally were to put the knight in the corner and take the rook outside.
KiaraAme chessGurAme chess
>>29045635Wasn't chess already solved by computers?
>>29045638Ya know I wonder if she browsed /x/ and heard of that I'd hate to imagine /pol/ of all places. Although it did get popularized a bit.
>>29045627Uh hello?Retard, Cover doesn't have anything to do with the indie you posted.
what's this apple visualization they're talking about? some sort of psychological test?
haachama cooking yummy chiken
>>29045617It could be. That or youtube has hololive in a rifle scope since they took down Chocos Dbd stream yesterday for ToS
>>29045678fuck
>>29045635chess is a very popular zoomer game in ||Scotland||, people play each other on their phones a bunch.
>>29045653Kiara is stalling hoping they stop their chess game and mention it for more subs
>>29045636Ame's not great at games by any stretch of the imagination, but I think people just like to bag on her harder than the rest because she's "supposed" to be the gamer.I do it too sometimes so I get it.
>>29045594But Gawr Gura is very happy!
>that little error noisethe dummy noisevery cute
>>29045491No shartia for Taiwan
Is Kiara x Haachama in JP or EN
>>29045667Numbers will increase after AmeGura collab is done
Is it just me or can Gura win with her queen now?
>>29045491nobody cares assfaggot
>why do you say Im bullying her?>THATS THE GAMEDominant
>>29045448>1. I want to see Hololive Poker matchesThis, honestly. It'd probably be a lot more engaging than chess because of the bluffing and mindgames.
>>29045587I love how that dress frames those tittiesboob bag is the best
>>29045704>discord spoilersGo and stay go
>>29045714EN
>>29045685watch both
>>29045687most people don't play chess you psychotic fuck
Just woke up, how was GuraAme collab and karaoke? Did she sing country roads in english?
>>29045670that's a meme image it's not actually used for real studies
I'm sorry chicken but I'm gonna continue watching chess kino
>>29045714English, they said
>>290456702 because my superior intellect works on abstractions instead of calling up memories of specific apples like most plebians
>>29045670Anyone that doesn't see 5 is an NPC
>>29045653Fuck 'em, Kiara and Haachama are numberfags
>>29045599holy based
>>29045704Return to whence you came
>>29045670What if im unsure if I can or cant see a apple?Like I can think I see an apple but im not sure if im actually seeing one or not.
TAKE TH ROOK GURA PLEASE
Latechama...
>>29045714Haachama's channel
>>29045702what did Choco even do wrong? I was watching that stream last night when it got nuked.
>>29045716Good news for them an hour from now I guess.
This is disasterWhat is happening?
She's literally giving it up to gura and she still can't find it
Gura..........take the rook............
>>29045714EN. Chaama is doing another english week it seems where she does morning EN and then JP evening.
AME JUST SITTING THERESMILING
>Kiara desperately delaying cause of overlapkek
Stop clicking the link unless you want to play dumb niggershttps://lichess.org/4oVvCpQj
Deez nigguhs really need pictures to think LMAO!
>Kiara is frantically messaging Ame and Gura to end while delaying Haachama
My sleep reps...
>>29045531>>29045618Kinda newfag here, are these recordings from roommates' accounts?
>>29045738pick 5
Where's the stream chicken and haachama?
>>29045728It was incredible anon. Go look for some reuploads.
oh nyo~
>>29045704lmao
tower...
Knight sac for Rook oh lord why
>>29045744They are sandbagging to boost Kiara's viewers
>>29045687chess sucks
>Kiara trying to delaykek
>>29045700It's that thing people were spreading around to check if people had an internal monologue or if their brain worked like some wild animal's or an Npc.
>>29045697she dropped a "you will never be a woman" in her last supa reading stream so there's a solid case for it
>>29045754lmao no
>>29045729Nothing about this chess game has been kino. Its more a chess teaching game than an actual match.
>>29045732cope
>>29045702Why is it that Mori can show off her tits but other stream thumbnails get the stream banned?
>>29045708I don't mean it that way. I mean like everything she does, no matter how disconnected or original from HER, people will still think it was born from HER.
>>29045722halfway between boob-bag and boob-tent is ideal
>>29045738The last one probablyYou have no visual imaginationYou are like some text based game, you follow inputs but cant come up with it yourself
>>29045670I see a full 3D model of colored apple. I can even touch it and eat it. Am I a schizo?
>they are delaying the collab because of ame and gurakek
>>29045738You're 99% of humanity congratulations on not being a dumb fuck
Anyone wanna bet if Kiara gets FURIOUS about Gura and Amelia going overtime on their collab
>>29045754I can play, but I will lose.
>>29045774UUUUOOOOOOOOOOOOHHHHHHHHHHHHHHHH
AME STOP THE CHESS GAME, KIARA WANTS TO STREAM
>>29045752It's not even on her channel you fucking ape
>check in 2 moveswomen can't into logic
Holy shit she did it.
>>29045728She sang I Believe I Can Fly by R. Kelly
>>29045757Well, Ame did her best without saying YOU DUMB FUCKING SHARK KIARA HAS AN IMPORTANT COLLAB NOW LETS STOP
chicken, i know you dont want to look bad in front of haachama with low numbers but you gotta roll with it this time
>>29045742Nothing. Some anons were guessing it was because of the cropped image showed too much cleavage when you look up the source but it got shot down when someone mentioned that Festival does the same shit with actual porn
>>29045445>>29045500>>29045462>>29045530Does someone at Youtube just fucking hate Hololive?
Just use your queens
>>29045531based
>>29045792But why?
>>290456701, visualizing has always been really easy for me, kind of blew my mind that some people don't visualize at all. Sadly it didn't translate into drawing ability.
>Sharkfags on 4chan are saying 'Two nukes weren't enough' lolContext: Among Us collab aftermathI think you can get a keen sense of the asspain this one caused just from the (you)'s, highlights including some calls for a second Pearl Harbor and one essay about how this exposes the 'true character' of foreign fans.
>>29045774how do i get a job as a cunny measurement expert
The viewers you little sluts, hand em over
>>29045811Well Susan is a jew so take that as you will
soooo... HER actually knows how to play chess?
>rookHow to identify the amerishart
>>29045766They are watching the chess match.
>>290456705
what is Haachama doing while all of this is happening I wonder?
is youtube shitting the bed for anybody else ?
Towa!!!
>>29045728he missed the unarchived karaoke...
>>29045780BASED!BUTDOESSHESNEED
>>29045751MENACINGLY
>>29045791your a new-type
I guess this confirms the narrative that Gura hates Kiara by pretending to not know she has a collab.
>>29045819>4chanLostchama....
>>29045725Chesslet detectedGo play checkers with the kindergarteners, I'll be exercising my mahjong skills at the local
>>29045791yes
God the constant OH NYOHs make me DIAMONDS. I'm glad Gura seems to be picking it up as a habit.
>>29045462REMINDER
Gura and Ame are inconsiderate bitches. I hope they graduate.
>Haachama Ch. 赤井はあと I'm gonna late 10mins!!! i'm sorry!!!!!
I'm retarded only realizing that the Kiara Hachaama stream isn't an offcolab because... Australia, what is Kiara even going to do?
Watson seems to be taking it easy on Gura.
>>29045819lol, do they really take this shit seriously?
>>29045819kek
Gura is annoying brat that's why I love her
https://lichess.org/SszKEyru
What are the chances Gura cancels tomorrow karaoke and only has the karaoke for members on friday?
>>29045696No. Computers can play it better than people but they can't solve it yet.
>>29045819There's people here that believe that unironically though.
>>29045822no lolget fuck chicken
>>29045774https://twitter.com/amanopikamee/status/1326746585443651584
>>29045824no just spongebob and musedash
>>29045825what is it called where you are from, anon
>>29045728They sang Tequila together.
Latechama strikes again
>>29045828Kitchen probably caught on fire.
>>29045819kek so chinks aren't the only glasshearts huh?
>>29045819Holy fuck where do they come up with these narratives. At least its targeted towards us.
>y-yeah I'm ready just one more minute please Haachama (COME THE FUCK ON AME FINISH HER ALREADY AHHHH)
M-my sleep reps.... I have to wake up in like 5 hours...
so why isnt the kiara collab starting?
>>29045817>Streaming during a power duo's streamThat'd be like streaming during Miko's return. It's suicide.
>>29045825and what exactly do you call it?
>>29045774How do you measure up boys?
>>29045819top fucking kek, I think I was the first person to make that joke in the threadI can't believe I made a bunch of nips seethe
>>29045819They've never seen us joke about his before?
>>29045819nipfags think a second pearl harbor isnt going to end in the obliteration of their country
>>29045819>japanese and english weebs are out for each other's bloodThis is gonna be a weird WW3.
>>29045819now that's some long-range falseflagging
>I'm gonna late 10mins!!! i'm sorry!!!!!hachama...
Stream delayed by 20 minutes
Haachama gave Gura has 10 min to win
im gonna late..
And once again, Ame is forced to tard wrangle, when in reality she just wants to fuck off and watch Kiarachaama. What a good girlfriend!
>>29045774who's behind the curtain
>>29045774UOOOOOOOOOOOOOOOOOOOOOOH
>>29045791Yes, and I know because I can too, and I'm schizo.
>>29045462thats probably why they are delaying the collab so they can try and fix it.
>>29045781wait, you can be a functional human being without an internal monologue? wow, i've got some googling to do. thanks for the answer, anon.
>>29045850She just came back home with her BF
>20 minutes delayHOLOEN Gen 0She's a good girl.
>>29045687People only play chess if they're in prison or a third-world country.
>delayed for 12 minutesGod is a Kiara anti
>>29045819>some calls for a second Pearl Harborweak banter jop bros next time call for a second 9.11
>>29045825I was always taught it was called the tower>>29045824
>>29045885>>29045886>Haachama delaying to watch the Chess match
>>29045640>I'll never have thisIs life worth living?
>>290456705 and 1 are based iron cage mental autism tiers, anything in between is npc tier.
Do you guys think Haachama will end up burning her house down this time
>>29045886waiting for the chess game to end is a smart move haachama
>>29045885>>29045886What's she up to?
>>29045885>>29045886latechama...
>>29045886>>29045885The EN curse
How strong is Haachama in chess?
>>29045885>>29045886 kiara is ditching her to watch ame and gura
>both queens still at starting position
>>29045819How can someone explain to them that it's one anti on twitter falseflagging.
>>29045886Gotta fuck the chicken before eating her
>>29045819>Pearl Harbor vs fucking nukesCome on, japs, you don't wanna do this.
>>29045869AMELIA I SWEAR TO GOD IF YOU LITTLE FUCKERS DONT FINISH YOUR FCUKING COLLAB IM GOING TO BEAT THE SHIT OUT OF YOU
>Gura shut up!NARRATIVES???
>Gura actually responding to Ame filling dead airlol this dumb shark
>I'm having a private conversation with chat, Gura. Shut up!WE DID ITWE KEKED GURA
>>29045871Haachama is late I thinkNarrative reason: cuz of numbers
>>29045670i challenge anyone who says "of course i see 1"to actually draw what they think they seeid wager 99% of the people who think they're 1's aren't actually, and will end up drawing something like 4
>>29045918Why are you posting your own comments?
Yeah Ame is the dom in their discord sessions
>>29045885That's funny, that's almost as much time as the Gurame collab was delayed by
>>29045905She just forgot the time of the collab and thought it was an hour later.
The curse continues
>>29045905>Haachama would rather watch a disaster chess match over feeding Kiara radiation poisoning
throws a hissy fit playing among us and now she's actively sabotaging her fellow gen members important JP collab. Why is Gura like this?
>>29045920She just has to play this and she wins
>Ame's "filling dead air" is literally just GFE inane prattlingLiterally perfect.
>today I had a burger...>you had a - >no gura, you're not supposed to respond>i'm sorry...
>>29045868There's a fun narrative about us in the current Holoan 5ch thread, actually. Apparently the Teamates here aggressively run this thread in the same way Nousagi dominate the fuck out of their thread, and try and stamp out discussion of other ENs. Then they decided everyone on 4chan are poorfags since Ame doesn't get that many supers.
>Ame has reserve ketchup packets for emergencies
>>29045922gura doesn't know how the tiles move and ame has brain damage pls understand
RESPECT YOUR SENPAI YOU LITTLE SHITS
kek she responds to her anyway
>>29045685Porque no los dos?
>>29045910No, but her phone will fall revealing her face and Kiara will get the blame.
>>29045670It's the same apple with varying levels and shades of ambient, specular and diffuse lighting applied.
>>29045888Huke
emergency ketchup packets...
>>29045789Anon what I meant by that is she's still the same person. Now stop talking about her past character.
Alright lads, someone make an "emergency ketchup" coupon
>doesnt have a ketchup bottle>keeps random packets of ketchup??
This is like watching an adult beat up a toddler.
>>29045920Haachama is actually pretty intelligenthttps://www.youtube.com/watch?v=Brx3TikoO_s
EMERGANCY KETCHUP
>gura just wants to talk with ameCUTE
>>29045824Sorry about the tower reply, phoneposter here and misclicked
>>29045934It's a rough test since drawing ability gets in the way.
>>29045924It's not, it's just a joke not meant to take seriously, and most likely not even posted by an american.
>>29045819KEKhttps://www.youtube.com/watch?v=mzDkwqCF7fs&ab_channel=Piscator
>>29045946>woman talks to you about any topic>"GFE"
watson's emergency supply of ketchup packets
Haachama and Kiara don't want only 10k views
Emergency ketchup packets, I literally can't stop laughing.
>gura responds for a second time>ame slowly turns towards gura>gura turns to face ame>"Gura shut up"I laughed hard, I need to see this clipped
>>29045833sneed is a reddit meme
>>29045968Why not just order a cheese pizza?
>>29045973np
>>29045963you dont keep spare packets of ketchup when you go to fast food places?
I love these two so much.. I love HoloEN
Ame staring at Gura like "what did I tell you?" after she asked where she got the burger made me genuinely laugh out loud.
>>29045948Now that's a fun narrative.
>>29045934>Seething over a fake test.
Is it me or Ame is much better at chess than the last time she played with Kiara? Was she just playing retarded the last time?
>>29045981Haachama doesn't care about numbers though. I bet she's watching Gurame instead of getting ready for Kiara
>>29045979yes
>Ame started using her angry face more nowshe finally realizes how cute it is.
Wow ame must have practiced a lot of chess to get this good after her game with Kiara
>>29045981They won't even get that many with the shadowban.
>>29045943is Suisei intimidated or horny? what is that face trying to cenvei
>>29045984/tv/ is reddit incarnate
>>29045979girlfriends love to tell you about every trivial event and challenge they had to face
>>29045819They thought this was serious when "Ryan Gosling" said it too. There's a certain brand of memery that they just don't get.
>ame speedrunning now so that her little sister can start her collab streamCute!
>>29045979Never had a girlfriend mate?
>>29045694>Nah, she's still bad. Just not borderline clueless bad as before.
GURA REALLY DOESNT GIVE A FUCK ABOUT ANYONE OTHER THAN AME HUH? AME WANTED TO STOP BECAUSE OF KIARA COLLAB SO THERE WAS NO OVERLAP BUT NO. GURA WOULDNT LET HER BECAUSE GURA IS A SELFISH BRAT
Yo Gura, wtf are you wearing?
>>29045722curtain is my favorite because she could be hiding a nice belly surprise behind it, girl has massive tits lifts up her curtain and you get to see a nice grabable belly it is perfection
>>29045997It only looks that way because of how terrible Gura is.
>>29045948Based 5ch schizo narratives
>>29045774
>>29045948Bro, that's not a lie. Teamates do run this thread.
>>29045948>Then they decided everyone on 4chan are poorfags since Ame doesn't get that many supers.No, its because our country is on fucking fire. Those nips have no idea what we're going through
>>29046005god, gura's l2d is awful
>>29045968my blain...
>chess match is still going
>>29045963Bottles cost chump change. Stealing 50 ketchup packets at some fast food place is free.Mind you this is me typing while emulating Ame's poorfag brain.
>>29045963I do the same thing. No point in throwing out perfectly good ketchup. I use up the packets before I use the bottled stuff.
>>29046020brrat
>>29045638This was literally mainstream shit that every podcast was talking about. I get not being a normalfag, but go out of this site sometime, holy shit.
>>29045984>reddit memes come from reddit boards owned by reddit discordsWhat'd you expect?
>>29045997>Was she just playing retarded the last time?She said at least part of it was pretending to be retarded.
>My turn to fill the dead air!>Silence
>>29045984never understood the fascination with that episode/moment
>>29046020this gura feller sounds based to me
Is Kiara/Haachama an offcollab? They're both Australian right?
what would the emergency worth using those ketchup packets be if its not having enough ketchup for fries???
>>29045975sure, it wont be a pretty apple, but if you can truly visualize 1, you should be able to correctly identify the form, depict shadows, local values, textures, etc>>29045998>seethinglmao, just pointing out that these posts always devolved into autists trying to shit on "npcs" when theyre really just falling into dunning kruger
>>29045997she was pretending, and then realized she had to defeat an unpredictable retard
>>29045946>Woman is talking to viewersOMG GUYS THIS IS GFE
How is Gura worse at chess than Kiara
>>29045997Either practice or she learned from that mess of a game
>>29045997Kiara wasn't playing as braindead as Gura is. Gura makes mistakes that are within Ame's ability to punish, Kiara made mistakes that Ame didn't have the skill to punish
>>29046016this is /jp/, what do you think anon
>>29045948disturbingly accurate
>>29046030It's better than yours
>>29046022Is this Gura's cool big sister who beats the shit out of you if you make her cry?
>>29045949You don't?
>>29045685That's what jetri is for
>>29046020This is true but chumbuds will deny it
>>29045961Same person but not the same character.
>>29045979Why else would a girl talk to you about inane bullshit?
Hey rrat, are you ogey?
>>29045948This is true!
>>29045948/hlgg/ is pretty even, no one group has total control of the thread at any given moment. But a few schizo can whip any particular group into a frenzy easily.
>>29046032Only 30 more minutes anon...
>>29045885She's going to get pregnant?
>>29046034it's true though
>>29045948what do you call a schizo who is right?is there a good word for that?
>>29045997She was operating on 2 hours of sleep last time. Probably pretending too.
>>29046062i got owned
good move by gura actually
gurame doing a pretty good job of carrying this kusoge
Why did Ame go dead quiet?
>>29046016>>29046011If them talking to me about inane shit I don't care about makes them my gf then literally every woman I've ever interacted with.
>>29045968>tfw no Haachama gf to feed me pepperoni
>>29045823>>>/pol/
>>29046052Yeah, I'm thinking you haven't mate.
>>29046020Gura is retarded and didn't remember there was a collab.
>>29046086She had to start thinking.
>>29046038And?Nigger, it's a single word post. I know it was everywhere. It's also related to NPC posting here, and guess where we are
Reminder that people were literally crying for this to happen and now everyone hates it.YOUGETWHATYOUFUCKINGDESERVE
chickenfag here I don't blame gurame for overlapping it's not their fault
>>29045774Neck yourself pedophile. You should get banned for child porn
>>29046071Groundbreaking observation
>>29045986the pepperoni oil still imparts flavor after picking it out
>>29046086She's trying her best to masturbate to Ame without getting caught.
>>29046086too distracting for gura
>constantly wants her attention>always wants more time with her>talks about her non-stop on solo streamsShe really is the biggest gosling
>>29045948If I wasn't a NEET, you can bet your ass I'd drop some fat akasupas for Ame every stream. The nips are right sadly, I am a poorfag, I can only afford a tier 1 membership. Teamates still run /hlgg/ though.
>>29045819Tell them that it's just a joke jesus christ
>>29046099But I love it
Anyone else who was initially planning to go to bed after the club51 but it's been so long might as well watch chickenchama now?8am bros who lost control of their lives where you at
5D Chess With Multiverse Time Travel stream when?
YOU GOT A QUEEN AMEUSE IT!USEEEEEEEE IT!
>>29046089fuck off kike
>>29046085>kusogeIts chess...
>gura (incorrectly) quoting home alonei love this shark
Ame why???
>>29046072I have more female than male friends.
this is underwhelming compared to Kiara/Ame chess, honestly. Just finish this up and let Kiara stream already
>>29046119chess is shit.
>>29046006Why would a channel as old and established as HAACHAMA's get shadowbanned?
>>29046087No, you paying attention to them when they tell you about inane shit is what makes them your gf
>>29046115I fucking love that game.
>>29046005is blessed
>>29046093I'm surprised she even remembers her own streams
>>29045819they were laughing
Okay I have to be completely honest here, I want to suck on Ame's nipples and squeeze her soft tits so fucking bad.
>>29046102Thanks chickenbro, I know it's not you guys it's just Gura antis who need to kill themselves
STREAM BIRD.
I was expecting kino... not this...
Do you think if you listen closely you can hear Ame's head hole make noises when she thinks?
>>29046123t. Kiara
>>29046124Cope
This collab has gotten really low energy really fast. More than it already was to begin with.
>>29046118tomato tomato tomato?avocado avocado tomato
>>29046119Every game I don't like is a kusoge
>>29046129there's no excuse for any of the shit that's wrong with youtube.
>>29046097I was trying to reply to >>29045697
This chess match was a mistake
ame please just win as soon as possible so you don't overlap the chicken onegai.....
>>29046020https://files.catbox.moe/9fjses.mp4
>>29046112Listen, anon, I take photos of the monkeys throwing shit at each other at the zoo to bring back for your enjoyment. I'm not going to run into the enclosure and get covered in shit myself trying to get them to stop fighting.
>>29045738You don't have to literally see it like an actual physical apple, you just have to "remember" what an apple looks like.
>>29046119I prefer chapayev.
>Gura watches ChessWait I thought she didn't know how to play?
Ame could have won this game like 10 moves ago but is making "mistakes" so that Gura learns more about chess
>>29045948Now this is a schizo narrative
could you fuck ame's head hole?
>>29046151Pretty accurate.
>>29046020meds
>>29046119Its 2020 bro and zoomers have never even touched a real chess piece.
>>29046114>8 amHello fellow EUbro
i want to stick my dick in ames head hole
pain-peko
>>29046104Based
>>29046104https://files.catbox.moe/3fx4sh.webm
>>29046123NOOOOOOO MY AMYGOOHRA NARRATIVESHITPOSTINGGGG STFU ITS KINOKNKOINKINLOOKINLOINKINKOKINOKINKINKOIKIKNIKIKNOILOKINKINKIKNKIKOKKINKIOONKIKNKIKONKIKONKKNKIOOL
What is Kiara thinking right now?
>>29046166she watches it like 95% of this thread is "watching chess" right now.
>>29046119Most anons here know chess about as well as Gura and are upset they can't comprehend it
fuck me 1 collab host and THE GAP is almost 10k
>>29045595>at the start of the splitWhat?
Dont do it Ame
>>2904609942-43k people holding steady is impressive for what should be (and is) a painful part of the stream.
oh come on, the only ones having any fun are /u/ fags with their deusions
>>29045948I'm pretty sure chumbuddies overlap with teamates almost completely in here. I'm both, for one.
>>29046166I watch starcraft and I dont know how to play that.
>>29046183>ENNNNNNNDDDDD
>>29045819>>29046135What do they think 4chan is,some kind of zoo?
>>29046183God I want to eat some more yellow pussy
Gura just won lol
Gura's too much of a tryhard to make this fun.
>>29045948Ame is in control
>>29046147that's what happens when you try to learn chess for the first time on stream
>>29046093Why do you think the stream was 30 minute late. I bet Ame took the blame for that shit.
>>29046183Probably waiting on haachama to be ready
Finish her Ame!Kiara and your little sister want to stream, they're shadowbanned, they need all the help.
>>29046183END
>whose idea was it>yoursmy sides
>>29046080If anything chumbuds mostly run this thread
>>29045180Chess is a game they'll have at school and something they'll pull out when the teacher decides not to teach. Did that never happen to you?
>>29046182Do you want to talk about it?
AME YOU HAVE 3 MINUTES TO FINISH THIS GAME!!!
>>29046104seething more
How mad are KFP cultists right now?
>>29046104No U
>>29046197I prefer insane asylum, but a zoo ain't far off.
>>29045819jesus i was not expecting these responses when i looked it up, the japs really hate themselves
>>29046182are you ok buddy
gura wins
>>29045595never happened but you won't provide proof and just say you won't spoonfeed like all schizos
>>29046200Are you sure about that?
>>29046182meds
>>29046197they think correctly.
>>29045968only the smartest can understand haachama. That is how intelligent she is.
>kuso gameIT'S CALLED SHITTY GAME. SPEAK ENGLISH MOTHERFUCKER STOP BEING CRINGE CUNTS
>>29046156Ah that's fine thenI was gonna reply myself to that, say the fags a fool. Theres good reasons and evidence to some of the girls coming here or other boards but thats an asspullMade me think tho, is /x/ filled with femanons?No single male I ever met irl is into /x/ type shit, but the vast majority of chicks are
What's 5ch saying about this chess match though
>>29045968I WANT TO ____ HAACHAMA CHAMAAAAA!?
>Big Gamer Move
>>29046192Chumbud hereI defend my oshi AND my oshi's oshi
>im gonna do what they call a gamer moveGURA NO!
>>29045346Me too.
>>29046213we played card games like normal people.
>>29045922I mean it's silly to move their models around all the time, sitting in one corner means they don't cover up any part of the game interface.
Does 5ch understand the implications of someone typing in full caps?
>>29045948This is the most believable narrative to come out 5ch
>>29046123the conversation and discourse is 50x better, which is the only thing that matters during these chess collabs.nobody actually gives two fucks about the gameplay. its not like its a world class game between magnus and hikaru
I'M GONNA RAAAAAGE QUUUUIIIIITTT!!!!
>>29045981Its 2 AM in NA, people holding out until the end of GuraAme are gonna go right to bed for the most part. It's also about 4 hours earlier than Kiara's normal audience. Haachama's only gonna get the stragglers and whatever she can bring from her own side.
>>29046224Remember the black ship shit?
>>29046137I wanna slap those milkers hard and motorboat them
SHE'S GONNA SAY IT
>>29046220I have enough displays to watch both at the same time
>>29045822I-I’m trying Tenchou please be patient
>>29045819>being so retarded you don't understand simple jokesTwo nukes really weren't enough
KFP??? ENJOYING YOUR CHESS KINO?
Ame Kiara chess game was so bad it was funnyThis is just sad and boring.
>>29046192It's the same for me as well. I ended up being a trinity fag but not because I hate Mori and Kiara just that the trinity streams at the best times for me.
This stream probably should have ended 30 minutes ago.I'm more surprised that Gura couldn't read the mood and decided that she needed to keep playing when she fucking takes 3 minutes per turn.It makes it even worse when Chicken has a pretty major collab coming up and they even delayed it to let them finish, yet she has yet to come close.
>>29045948I assume they came during Ame hours to believe this.
GURA JUST SAY IT AND END THE STREAM
>>29046103Yeah, and that's why people can't disconnect HER and Gura for some reason.
>>29046233>sticks entire foot in mouth
>>29045968this is exactly how I eat pizza...
ame is throwing so hard
>>29046220nearly not as much as Kiara herself. Her last JP collab went disappointingly and now this
>>29046220Not mad at all, maybe you should ask Haatons. It's on her channel after all.
>>29046224Dude the emperor of Japan himself nearly converted to Christianity after the war
GUYSGUYSGUYSWhat ifIf, guysKiara doesn't give a fuck about the overlapAndGUYS CAREFUL THIS IS LITERALLY SCHIZO POSTINGand it's delaying just because Haachama is actually late???
>>29046022 is this what Gura would look like when she grows up?
>>29045905Haachama has been late to more streams than she's been on-time to. She even did an apology video a year ago (though she reverted back anyway).
So this is the power of -1200 ELO chess
>>29046222>>29046233Pedo cunt
>>29046029>our countryAnon half this fucking thread consists of SA and SEAnigger ESLs shitposting and spamming doxx.
>>29046220chickenfag here, i dont blame them if they overlap, stream got shadowbanned anyway. Plus, gura just wants to have fun with her, let her have that.
If Kiara does the same thing as Gura, just mindlessly overlaps her stream with her coworker's big collab, she would be hanged drawn and quartered by you guys here
>>29046267thisand it's all because of youtube chat retards who don't understand context
>>29046110I dont usually like yuri but they should really fuck
Kiarafags are starting to get uppity huh
>Delayed again
>>29046213It ain't 1997 anymore, old man.
Dead silence lmao
>>29046222AW JEEZ!
>>29046269Yeah, pretty much. What I've seen from Mori and Kiara was pretty nice though, it were mostly singing streams.
>>29046237I dunno, I tried going to /x/ a few times but those dudes aren't even shitposting, they really believe that shit.
This is an incredibly boring game of chess. I demand kino.
>>29046290When isn't she late?
>>29046072friendzone
>>29046290b-but my narratives...
>>29046290Bro stop with the Narratives already. Shizos are already shitting up the thread.
>>29046296Anon, these plays are lower than 900
>>29046235
>>29046270Gura just really likes spending time with Ame
Kiara doesn't want to overlap lmao
>>29046290take your meds, faggot
>>29046192same
>people complaining about gurame chessthe fucking close the stream and stop watching you faggots. you dont have to act like a fucking rose twitter user and complain about every fucking thing.they're not fucking streaming for you. they're playing to have fun with each other. gura wanted to learn and keep playing, and ame wanted to teach her. now fuck off.
kfp on suicide watch
>>29046183
>>29046263the kiara ame chess was hilarious in how shit it wasthis is just shit and not funny
>>29046243shes literally spouting reddit memes
Kiara is pathetic
>>29046298
Seeing the fucking loading spinner over Gura's head ever time she has to make a move is adorable.
>>29046267Kiara and Ame chess match was funny cuz they both were clueless.Ame and Gura feels like an adult playing with a child and trying to not win too fast so they dont cry.
>>29046220Why would I be mad?
>>29046290>or the curse of EN strikes again and they are having technical difficulties
Holy fuck Chicken why are you such a numberfag. Just do your collab.
>>29046290That can't be true
>>29046290Fuck off hlg your schizo narratives cant help you here.
End the stream for Haachama, please.
>>29046228then ask her to restore vods on twitch and you can confirm it by yourself
Are they actually waiting for the chess game to finish? It's shit, just start so I can watch something else
>>29046243
Name ONE (1) time gura went out of her way to do something supportive of her nakama, I'll wait.
SOMEONE PLEASE CLIP THAT
>>29046290Anon, you can damage somebody with narrative this strong, be careful with it.
>>29046290Considering the time where Haachama is right now, she probably went for dinner or someone else was using the kitchen
>>29045670>seeing things in your headthread unsurprisingly full of schizos
This chess game isn't really a game, it's just endearing teaching lesson.I like it, but I wished they could wrap it up for Kiarachama.
This is what it looks like when they play chess and you want them to play grand strategy LMAO. These girls can't even play minecraft without getting lost going in circles for multiple in-game days, and that's with a map.
Way too much dead air in this match, feels like I'm watching an art*m*s stream.
>>29046192i have both their memberships and i hope they can confess their love for each other soon
>>29046302what, you didn't know that /hlgg/ stands for /hololive gura general/?the only reason the other ENs are allowed on here is because they sometimes show up in Gura's streams every now and then
>yen be a knight controlled by commander Gura, sent to the front lines with as much thought given to your safety as to what she wants to eat tonight
>>29046327>Sitting in silence is spending time with Ame.I guess just breathing the same air is good enough for this lewd shark...
>>29046213>Did that never happen to you?Nope, played connect four, poker, uno, go fish, Life, monopoly, checkers but never chess.
Apparently putting too many exclamation marks gets you a 5 minute chat ban. Thanks Ame.
>>29046237Thought /x/ were just LARPers but they're so into it, it seems like genuine mental illness.
Wow this is some riveting commentary... fucking clowns
KIARA JUST FORGET ABOUT THE NUMBERS FOR ONCE AND JUST STREAM
I wish they play minecraft next week
>>29046220I'm not mad that much at Gura, but at the hypocrisy of the fucking cumbuds
how much do you think kiara is seething right now?
GURA
>>29046354Can I get context/a timestamp for this one?
oh my god she didnt
>>29046224well they were colonists up until the defeat. at least they're consistent.
>>29046359Does she eat kangaroo meat?What does it even taste like? I was surprised discovering Aussies eat it
>>29046290your meds anon, they're waiting for you
I’d take meds if I had insurance
goorue....
>>29046220Im watching both. Sucks more that haachama's stream got shadowbanned.
>>29046361Why the fuck does it matter? Just switch streams if you like Kiara better.
>>29046335HAHAHA
>>29046290they delayed it again, fag. Your narratives are wrong. Kiara and Haachama are waiting for the Gurame stream to finish up
>>29046363>watching any trannyshark streams past the first one
desk-kun, ganbare!
Gura not even reacting to her queen getting taken
>>29046336agreed desu, there's not enough smug energy in this one
>>29046375Its in the Aussie stream retard
Gura please dont
GURA WHYYOU JUST HAD TO MOVE IT ONE SPACE
>reverb with desk slam>caring about clips>used to be subbed to xqcwhy is this shark so addicted to twitch culture?
>>29046046Please tell me this is a joke.
JUST LOST THE QUEEN TO A PAWNI CANT TAKE THIS AAAAAAAAAAAH NIGGERMAN TASUKETEEEEEEEEEE
>>29045670>His brain men dont describe the images to him
>>29046380shes frying
>>29046331same
See if Amelia was actually competent at this game, she would have known how to end thsi game a long time ago.The set of moves to win are not even that complicated.
KFP IN SHAMBLES
>>29046324>-
>Gura willing to smash a table and cripple her hand for contentThat's my girl.
>>29046339Someone needs to make a whole edit of this.
Gooora....
>>29046235ばか
>>29046382Gura said Latinx
>>29046182These posts always look infinitely more insane than the people it's supposed to mock.
How deep does this rabbit hole go
>>29046290meds faggot
>>29046361Was cute for a while for that reason, but is starting to drag imo.I thought I'd hate it so I'm not mad, but this was never going to be the AmeKiara kino either.
hey kfp bros? you okay?
>willing to injure herself and cause serious property damage just for contentWell at least she's dedicated.
>>29046417I like this trinity
>Gura joking about how great the clip is going to be the day she accidentally destroys her glass desk on stream>THINK OF THE CONTENTI love this girl so fucking much
>>29046224>taking any chan seriouslyYeah, and the above poster actually wants to murder Gura.
>>29046398>she didn't notice
>>29046363Did you enjoy watching someone play Minesweeper?
Haachama forgot to thaw the chicken and has been microwaving it for the past 20 minutes
>>29046403Regardless where it's hosted the more views the more people are likely to sub to her.
Haachama... your stream...
>>29046324anon...
>>29046359>dinner at 4pmAnon, I...
>>29046375It's not her stream. Haachama has control.
>The day of reckoning
ARE YOIU FUCKING SERIOUSWHY ARE THEY SO FUCKING BAD AT CHESSAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
>>29046298pedo is latin for child, so yes, that is a child cunt
>>29046391I just feel bad for them since they're shadowbanned.
Why is Kiara shadowbanned again?
>>29046418She's dragging it because she wants to spend more time with Gura, she'll just never admit it.
>>29046411What do you think autist?
The absolute state of the KFP
>>29046425gura cares so much about entertaining her audience!
>Did you take my queen? What the heck man...Gura you sharkbrained shark
>>29046394I don't think I've seen a single Haachama stream that hasn't been delayed.
>>29046414Just like in my doujins
>>29046427SOON
>>29046386She said before she already tried it
>>29046290sorry guys im fingering haachama
People not realizing its on Haachama channel and she is delaying the stream not the chicken
girls too stupid to ever had a bf
>ame's pawn takes gura's queen>youtube buffers for 15 seconds>the stream resumes playing and they're back to low volumeThanks youtube, now I'll have to wait til the game and the stream is over to see what the immediate reaction was like
>>29046414NIGGERMAN IS DEAD REST IN SAND
>>29046393kek
KFP CLOSING DOWN...
>>29046409do your roommate reps
>>29046192Same.Amelia and Gura are both my favorites, just about even, by far. I love them so much and am so glad they make for the best collab team too.
Imagine not wanting to risk serious injury to impress the girl you like.
Kiara is on suicide watch
>>29046427What's the point of glass tables?
>Haachama collab won't startThe fuck?
THE NUMBERS KIARA
>they are actually stalling until the chess match endskek
>>29046457>redditjakgo back
Gura confirmed to want it to hurt to feel alive, and make clips.
>>29046220It's just gonna be Kiara and Hacchama shooting the shit anyways. Not exactly stream of the month material.
>>29046436Yeah, why ya asking is something wrong?
>stream is gonna go live as soon as chess ends
Please finish her already Ame, set us free.
>>29044907who made this poll?
>>29046254>2AM in NAYeah not on best coast.
>>29046447Implying that she wouldnt just cook it as is
>raged and didn't even know it was the queen lostGura is a woman of culture
Where the heck is Haachama
Kiara you fucking numberfag let Haachama start the stream already
The only good thing about this is that maybe Kiara won't have any tech issues thanks to the delay.
>>29046456Holy shit don't remember him being this greasy
>>29046046Yeah it is. How else would they cook together?
>>29045885>The virgin HaachamaShitty, short, quick and lame message with bad English despite living in Australia for years>THE STACY POLKALong full detailed message with perfect English without having stepped a foot in a single English speaking country in her life.
>>29046457>wojackkill yourself nigger
>>29046414
jeez Kiara just quit already and become statistician if you care about numbers so much...
I don't understand people that get frustrated at this kind of shit. It's just funny to me to see them do dumb shit.
>>29046453It's nearly 1830 faggot do your timezone reps.
IKUUUZOO
>>29046436Yes?It's not like AmeGura are intentionally trying to ruin the haachama collab, why would I be mad?
>>29046418She's not competent, but she's also teaching Gura and setting her up for moves because this is literally Gura's first game.Go watch chess players play chess if you expected to see a real chess match here.
>>29046485Smashing them for fun
>Haachama's too busy watching this trainwreck to give Kiara the time of day
>>29046485it's the excitement of it randomly fucking exploding some day
HAACHAMA Live
gura's not doing too bad for her first m->queen taken by pawn
>>29046475Gura didn't even realize it was her queen that was taken until like 20 seconds later
this isn't funny anymore ame
>>29046474don't start this shit again. Just take your copium pills
>>29046506it's sweat from being drunk all the time
i literally can sense whats happening between kiara and haato right now.haato: lets start the stream, please kiara.kiara: SHUT THE FUCK UP GURAME IS STILL LIVE AND I WANT 40K VIEWERS.
>>29046475She didn't even notice it.
>>29046438yeah thats typical twitch behavior, do anything for clips
Kiara is so pathetic holy shit
>>29046427Someone should shop a gura stream here
>Sorry Kiara I can't keep delaying any longer, I usually always start on time...
>>29046290Kiara is the biggest numberfag of all time. Of course she cares. She is literally seething as we speak.
finally Haachama
>>29046485You can squeak your feet on them
HAACHAMACHAMA
FINALLY
Haachama is live guys
>>29046463Considering how retarded this thread can be? You tell me.
BEST INTRO PLAYING
>>29046386It's just tastes like really lean beef to me
>>29046505You wish lmao
Bailing on this boring ass chess match. I heard Haachama's music starting.
TIME FOR CHIKKEN
IT'S STARTING>IT'S STARTINGIT'S STARTING>IT'S STARTINGIT'S STARTING>IT'S STARTINGIT'S STARTING>IT'S STARTINGIT'S STARTING>IT'S STARTINGIT'S STARTING>IT'S STARTING
I'm so out of the loop right now with this stream that I'm not even processing what they're saying anymore and it's all just white noise with how long this has gone.
>>29046409It's no secret she loves streamers, when she was talking about monitors before she said she usually has a stream open on the other monitor.
HACHAMA CHAMA
Do you think you could actually make Gura smarter by fucking her shark brain through her ear?
HAAAACHAMACHAMAAAAAA
>>29046457/g/ is two blocks down
>>29046508>The virgin HaachamaShitty, short, quick and lame message with bad English despite living in Australia for years>THE STACY POLKAGoogle Translate
>>29046499>>>>>>>best coastWhy are commies like this?
HAAAAAAAAACHAMA CHAMA
>>29046474Pretty sure that's the opposite of how it works.
>>29046537alright we get it, the stream started so you can shut up now
Alright see ya shark, Haachama is on
>>29046489>>29046510relax, i dont have a lot of pics on this machineat least it wasnt posted in forced irony
>>29046541>I usually always start on time...What did you do with the real Haachama?
finally the REAL stream starts
>>29046532I didn't know alcohol activates your sweat glands like that
>>29046467well, now its confirmed
So has Ame learned how to end a chess match?
>>29046531 but gura is and jay lives in the uk you fags have nothing
>>29046457I'm even worse, lmaoAme would mogg me bad
chess delay narrative demolished
>Haachama overslept>/hlgg/ assumed Kiara was numberfagging and delaying the collaboh no no no
>sleepinghaachama....
>>29046512It's haachama's channel though.
>>29046361Can you faggots for real just shut the fuck up? If you want to watch the other collab that bad then go watch it? The girls have no obligation to stop streaming for others whatsoever unless it's 3d, debut or anniversary streams.
>>29046485They go well with rooms with neutral colors
>Haachama sleeping at 6pmS-Sugoi...
Kiara is lagging
what's with Kiara's gain? check your settings retardchaama
>I was sleepingWe all know that is false
Kiara's talked on stream how she makes an effort never to overlap with other ENs. Most others try too but don't really care too much. Ame's stream occasionally overlaps into Gura's. Bird ends up picking the trash timeslots for NA.The fact that one of the biggest collabs right now is bleeding into her collab has got to have her seething.
>Haachama was literally just asleepAnd with that, all naive rrats evaporated
>>29046518No that's not what I'm getting at. Unless Amelia is a horrible person she probably wants to fucking end this chess game as fast as possible to stop how boring it is right now and for them not overlap Kiara/Haachama. The fact that she isn't ending this game means she literally doesn't know how to.
>I was sleepingDU U RLY BELEEB?
Haachama was sleeping.......
>>29046474yeah thats exactly the opposite how it work
>>29046574don't post then faggot
Haachama it's 6pm...
Ok everyone, you can close the other stream, Haachama is streaming
>kiara collabing with the one JP who can collab with the other ENs?????????
>>29045696Computers have issue's, they can miss very long specific lines due to the basis of their algorithmStockfish (the most common engine) is estimated to be around 3500 elo while the best human is 2850 (a 200 elo difference should give you around 98% winrate)
FUCK I HAVE A DENTIST APPOINTMENT IN THE MORNING BUT I WANT TO WATCH CHICKEN
>>29046590fuck off pedo fuck
>>29046593>Taking /hlgg/ seriouslyYour fault
>>29046549it's amazing that red alice's oshi is haachama
oh no its this bgm
Haachama has to pretend that she was literally sleeping cause Gura was too autistic to read the room...Haachama chama....
Is it only me that, hate when Watson show her teeth. Make me uncomfortable for somehow
Haachama...
>>29046331>>29046417same
>Haachama just going straight into it without introductionsShe really is just an NPC going off and doesn't interact with people.
>>29046587I was talking about Ame...
>>29046548Redditnigger you arent smart just because you dont like to have fun
>>29046386It's gamey, like an amped up lamb or beef cut in flavour usually. You tend to want to stew it or be careful with how you cook it because it goes tough real fucking quick if you're not on the ball. It's cheap as fuck, incredibly widespread and excellent lean protein. Plus it gets rid of faggot roos, which is always a bonus.
>6PM in AustraliaJesus, how fucked up is Hachama's sleep schedule?
>Shadowban lifted
>haachama lying to cover for kiara
Fucking hell, finally I'm free
>>29046612Yes she is very retarded
>>29046590UOOOOOOOOOOHHHHHHHHHHHHH
>>29046590I thought this was an anorexic skeleton Gura in the thumbnail
ko ke ko ko ko
Haacha is talking! Like actually trying to hold a conversation!
Haachama is so fucking nervous, wow
>>29046508literally translated by a dude in the chat.
burned her pot...
>I burned my potHow?
Told you Kiara is a fake ass bitch faking her excuse just like Lofi
>>29046590UOOOOOOOOOOOOOOOOOOOOOOH
>chickenfags ITT choosing a random stream over gurameholy fuck thats depressingwhy do i feel like chickenfags are secretly the biggest faggot contrarians? chose kiara because she was the 'unpopular' one, so they could feel special for being a part of a secret club.fucking gross.
>>29046590UOH
>Watching haachama everNo thanks homie.
I feel like Haachama is going to have a hard time with Kiara. Unlike Ame, chicken is not dumbing down her English.
Is anyone actually enjoying these two retards playing chess? They're not even talking
>>29046638ames smarter than gura by miles
Kiaras mind is already breaking
>ESL Kiara trying to understand Haachama's EnglishOh boy
>>29046008jealous of watson, probably.
>Kiara's shit sound qualityMan this takes me back to the first few streamsGood times/
What the fuck was that picture
>>29046626Where do you think you are? Go the fuck back faggot.
>>29046637why is Suisei so kind as to leave off a dollar?
>>29046590>starts licking belly button
>WHAT THE HELL IS THATit begins...
>>29046625They actually like when you sleep in the chair so just stay up and nap in the chair anont. hygenist
>>29046623Hachama was the one who asked for the collab since it's on her channel
>>29046659Who is Lofi? You mean Iofi?
>>29046626Sounds like someone's jealous of my daughterwife's pristine cunny.
What the fuck am I looking at
Imagine not watching both streams
>>29046590Based
>>29046590https://twitter.com/amanopikamee/status/1326746585443651584
>>29046626
>>29046485Tempered glass is great when you don't have to apply any force against it, that's why tempered glass tables are fucking retarded shits.
inb4 Haachama self-doxx with reflection from water
>>29046624Neural nets are up to around 4500 ELO now, but we literally don't understand how they think properly anymore
>>29046427I didn't know this was possible until now, I'm kinda scared
is haachama going to fucking deep fry that shit?
Haachama what did you do to burn your pot that badly.
>>29046637>suisei
>Collab has been delayed by however long nowIt wouldn't be a Holoen related stream without technical difficulties
>>29046640>faggot roosWhy? Are they annoying for farmers or something?
>>29046590UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
>>29046686I VERY dirty pot
There are 42k people watching two people who are very bad at chess struggle through a match... astounding.
>>29046590Nice. I don't even need the full pic, I'm satisfied with the belly.
>>29046626kill yourself faggot
>>29046663I'm watching both.
>Haachama oversleepingI can believe it.
>Special pot
KIARA TALK SLOWER USE SIMPLE SENTENCES
3 minutes in including opening, and Kiara has already gone "What the hell is that"This will be good.
>>29046663Not a chickenfag, but I'm a hatton, I gotta watch it.
What the fuck is on Haachama's screen? It looks like footage from the bottom of the fucking ocean.
>>29046626Wherever you came from, you need to go back newfagchama
>>29046626unironically kys
>boiling chicken in her burnt potHaachama!?
>>29046224Wait who are they mad at? Gura?
mmmmmmm chicken
>>29046658i had a roommate ruin one of my pots once by forgetting about it and leaving it on the burner for a good 30 minutes after all the water had evaporated. its definitely possible
>>29046698Have you seen any of her cooking videos?
>>29046570>>29046615 not talking about ame retards thats already known
>>29046640Where you get roos for cheap, I found some in woolie and coles and they pretty expensvie (doesnt count mince coz fuck mince)
C H I K E N
Kiara is 28 and Haachama is 19
>>29046693Nene is already making sure it happens
>putting the chicken into cold oil
>>29046626You fuck off newfag
>add raw chicken to waterjesus
Just opened up the gurame stream. Are they falling asleep? Their eyes are barely staying open
Holy fuck turn down the gain on kiara my ears hurt
IT BEGINS
>surely you can't catch me if I keep movingOH GOD ITS HAPPENING ALL OVER AGAIN
Ame you missed the easy checkmate
>>29046663cuz haachama
>>29046658Haachama
when the fuck are we gonna get some irl cooking streams from the EN girls like this wth
>>29046590>>29046678Neck yourself. Go post on /b/ pedocunt. Not here
>>29046626Where do you think you are..
>>29046590Not sure if i should bust one or wait until the stream ends
>Boiling an entire fucking chickenHERE WE GOOOOO
>>29046663i'd rather watch my oshi than someone who isn't my oshi
>>29046663>Towafag having any opinion and calling others contrarians
chiken
>>29046735I thought it was water
Chumchuds getting uppity as usual, let the chicken have her spotlight for once you snowflakes
>>29046663Replace chickenfags with towa fans and its the same thing.
>the oil/water isn't even boiling
>Amelia still doesn't know how to ladder checkmateAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
>it's just a whole chicken in waterewwww
>>29046705It's kino
>cooking on Cold OilAAAAAAAAAAAHHHHH NIGGERMAN SAVE ME
>>29046728no wonder haachama acts like such a beta bitch when she collabs with literally anyone else.she has a major age complex
>>29046440I like girls who act dumb
>>29046716It's called fine cuisine, you uncultured fuck.
Who's ready for the inevitable draw?
>Kiara audibly fletching at Haato's nasty potOh this gun be gud
>>29046686A chestburster embryo.
oh my god ame end it you retard
Oh so Haachama isn't actually gonna cook something you can eat. She's cooking for memes.
is this an offcollab?
>>29046728Same with Marine and Shion. What's your point?
>>29046716Art
How long will Ame take to checkmate this?
>>29046590>no gillsevery single time UUUUUUOOOOOOOOOHHHHHHH
>>29046728She's 25 and her roommate's birthday is literally the easiest to find, anon...
>the pot wasn't black beforeWHAT THE FUCK
JUST FUCKING END THE GAME, IT'S KILLING ME HOW QUIET YOU ARE!
>>29046735even worse anon. it is water.
>>29046666kiara can actually speak japanese if there's any confusion
>>29046590UUUOOHHHHHHHHHHHHHH
>>29046763>oilPlease adjust your expectations, anon
>>29046658I burned my pot once, I turned the wrong cooking plate on and it was sitting there. Fucks up an empty pot real fast.
>>29046749>>29046626Please fucking kill yourself faggot, and when you're done turn 360 degrees and go back.
>>29046702Western roos are so numerous they're overtaking Eastern roos territory and tearing apart farmland and the fucking NSW government won't organise a cull last I heard.
>Just put a whole ass chicken in thereAlright. It's going to be one of those
>>29046749
>>29046702Yes, there's shitloads of them and hitting one at 150km/h on a highway is a regular occurrence. Lost count of how many of them have fucked up the front of various cars I've had over the years.
Amelia you retard
>It's not even boilingBut why
>>29046739Discord sex
how does haachamas setup work when doing these cooking streams?
>>29046702They eat grass and crops, and they're 7ft tall and can easily jump over 15ft fences, you can't keep them out of anywhere. Plus they hate dogs and can kill a dog with a single kick
>>29046768It's water isn't it?
Does Kiara not know about Haachama's cooking?
AMETHE QUEEN AMETHE QUEEEEEEEEN
>>29046626You're just encouraging them to spam more loli lewds, anonchama.
i love gura
>>29046663>chose kiara because she was the 'unpopular' one, so they could feel special for being a part of a secret club.The absolute fucking irony of this coming from a kenzokucuck
>The whole fucking chicken in thereJesus Christ what the fuck
>>29046735Not ideal but if you have non-stick then it could still work
wtf Haachama perfectly understands chicken, why were she and Ame just making noises their entire collab?
i love you gura and ame!!
>>29046749How fucking new?
HAACHAMACHAMAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Why the fuck does Haachama put everything in water
>>29046224What are these guys srsly mad at their own country because Gura got salty in the Among us collab? Wait, why are they even mad aren't they Japanese?
>>29046728I'm pretty sure Kiara isn't 28.